Protein Amino Acid Basic pI Calculator

Calculate basic protein pI with custom pKa values. Review net charge, residue counts, and exports. Build clear amino acid reports for chemistry lessons today.

Calculator Inputs

Custom pKa Values

Example Data Table

Example Sequence Length Estimated pI Charge at pH 7.40 Note
Basic-rich peptide KKRHHK 6 11.782 4.069 Many basic side chains
Acidic peptide DEDEED 6 2.725 -6.002 Many acidic side chains
Balanced amino acid set ACDEFGHIKLMNPQRSTVWY 20 7.155 -0.074 One standard residue each
Protein fragment MKWVTFISLLFLFSSAYSRGVFRRDTHKSEIAHRFKDLGE 40 10.467 3.069 Mixed protein style sequence

Formula Used

The calculator estimates the pI by finding the pH where total net charge is zero. Positive groups use this charge term: charge = count / (1 + 10^(pH - pKa)). Negative groups use this term: charge = count / (1 + 10^(pKa - pH)). Net charge equals total positive charge minus total negative charge, plus any fixed charge adjustment.

The pI search uses bisection from pH 0 to pH 14. It repeatedly checks the middle pH. If the net charge is still positive, the search moves upward. If it is negative, the search moves downward. The final pH is the estimated isoelectric point.

How to Use This Calculator

  1. Paste a protein, peptide, or amino acid sequence using one letter codes.
  2. Select a pKa set, or choose Custom and edit values.
  3. Set the target pH for net charge comparison.
  4. Add blocked termini, extra ionizable groups, or fixed charge changes.
  5. Press Calculate pI to show the result below the header.
  6. Use CSV or PDF export for records and reports.

Protein pI Study Guide

The isoelectric point describes one important state of a protein. At this pH, total positive charge equals total negative charge. The molecule has no net electrical charge. It may still contain charged sites. They simply balance each other. This balance affects solubility, binding, purification, and movement in a field.

Why Charged Groups Matter

Proteins carry charge through ionizable groups. The amino terminus can gain a proton. The carboxyl terminus can lose a proton. Side chains also matter. Aspartic acid, glutamic acid, cysteine, and tyrosine add acidic behavior. Histidine, lysine, and arginine add basic behavior. Each group has a pKa. The pKa tells when half of that group is charged.

How the Estimate Works

This calculator counts charged residues from the entered sequence. It then applies Henderson Hasselbalch style charge terms. Positive groups fade as pH rises. Negative groups grow as pH rises. The tool scans the selected range and uses bisection. It searches for the pH where net charge is near zero. This gives a practical pI estimate for study and planning.

Advanced Use Cases

Custom pKa values help when you compare sources. Different databases use different constants. Local structure can also shift pKa values. A buried residue may behave differently than a free amino acid. Salt, temperature, solvent, and nearby charges can change results. This page is best for quick theoretical screening. Experimental values may differ for real folded proteins.

Reading the Result

A high pI suggests more basic groups. A low pI suggests more acidic groups. The target pH charge helps predict behavior in buffers. If pH is below pI, the molecule tends to be positive. If pH is above pI, it tends to be negative. This idea helps in ion exchange planning and electrophoresis review.

Good Input Practice

Enter one letter amino acid codes only. Remove spaces, numbers, and labels. Include the mature sequence you want to test. Signal peptides, tags, and cleavage sites can change charge. Use the export buttons for lab notes, class reports, and comparison tables.

For repeated work, keep one pKa set consistent. This makes comparisons fair. Record blocked termini and extra charged groups. Small settings can move pI enough to change a purification choice during early project screening.

FAQs

What is protein pI?

Protein pI is the pH where a protein has no net electrical charge. Positive and negative charge contributions are balanced at that point.

Can this calculator work for one amino acid?

Yes. Enter a single one letter amino acid code. Keep termini enabled for a free amino acid style estimate.

Why do different pKa sets give different pI values?

Each set uses different reference constants. Protein environment, experimental method, and residue context can shift ionization behavior.

What does target pH charge mean?

It estimates the net charge at your selected pH. This helps compare buffer behavior against the predicted pI.

Should I include termini?

Use both termini for normal peptides. Choose blocked termini when chemical caps, fusion design, or modifications remove terminal charge.

Are post translational modifications supported?

Use extra negative groups, extra positive groups, or fixed charge adjustment to approximate modifications such as phosphorylation or methylation.

Is the molecular weight exact?

It is an estimate from average residue masses. Isotopic composition, modifications, salts, and unusual residues can change exact mass.

Why is experimental pI sometimes different?

Real proteins fold. Nearby residues, solvent exposure, salts, and temperature can shift pKa values from simple sequence-based predictions.

Related Calculators

Paver Sand Bedding Calculator (depth-based)Paver Edge Restraint Length & Cost CalculatorPaver Sealer Quantity & Cost CalculatorExcavation Hauling Loads Calculator (truck loads)Soil Disposal Fee CalculatorSite Leveling Cost CalculatorCompaction Passes Time & Cost CalculatorPlate Compactor Rental Cost CalculatorGravel Volume Calculator (yards/tons)Gravel Weight Calculator (by material type)

Important Note: All the Calculators listed in this site are for educational purpose only and we do not guarentee the accuracy of results. Please do consult with other sources as well.