Sequence Length Calculator

Paste sequences and choose cleaning rules quickly. See totals, averages, and composition highlights. Download tidy results and document your workflow easily.

Calculator

Paste one sequence, multi-FASTA, or multiple blocks.
Cleaning options
Counting options
Ungapped length is always reported separately.
Reset

Formula used

This tool counts sequence characters after applying your selected cleaning rules.

How to use this calculator

  1. Paste your sequence or multi-FASTA into the input box.
  2. Select Auto-detect or force DNA, RNA, or Protein.
  3. Choose cleaning and counting options for your dataset.
  4. Click Calculate to view results above the form.
  5. Download CSV or PDF for reports and sharing.

Example data table

Illustrative examples to show expected outputs.

Example input Type Options Expected output
ACGTACGTNN DNA Allow ambiguous letters Length: 10 • GC%: 40.00 • N: 2
>seq1\nAUGGCU--AA\n>seq2\nAUGGCUAA RNA Ignore headers, exclude gaps Sequences: 2 • Total: 16 • Ungapped: 14
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPT* Protein Exclude stop symbol Length equals residues counted without *

FAQs

1) Can I paste multi-FASTA sequences?

Yes. Enable “Ignore FASTA headers (>)” to skip header lines. Each record is counted separately for totals, averages, and N50.

2) What is the difference between length and ungapped length?

Length counts all kept symbols after cleaning. Ungapped length removes “-” and “.” so alignment padding does not inflate size.

3) How does auto-detect decide DNA, RNA, or protein?

It checks for U versus T and typical nucleotide alphabets. If the sequence contains many non-nucleotide letters, it switches to protein mode.

4) What does “Allow ambiguous letters” do?

It keeps symbols like N, R, Y for nucleotides, or B, Z, X for proteins. Disable it to restrict counting to strict alphabets.

5) Why does my PDF include fewer sequences than the table?

The PDF exporter is a simple one-page report. Use CSV to export every row for large multi-FASTA datasets.

6) Can I count gaps as part of sequence length?

Yes. Enable “Include gaps (- and .)” to count alignment symbols. Ungapped length is still provided so you can compare both measures.

7) Is my sequence stored anywhere?

No database is used. Results are stored only in your temporary session to generate downloads, and Reset clears the form state.

Related Calculators

hardy weinberg calculatoralignment score calculatorprimer design calculatororf finder toolexon intron ratiopromoter region finderpcr cycle calculatorgenome assembly n50fragment size calculatorpairwise sequence identity

Important Note: All the Calculators listed in this site are for educational purpose only and we do not guarentee the accuracy of results. Please do consult with other sources as well.